Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD117/c-Kit, Mouse (HEK293, His)

CD117/c-Kit protein is a tyrosine protein kinase that acts as a cell surface receptor for KITLG/SCF and regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, function, and melanogenesis .CD117/c-Kit Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD117/c-Kit protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

CD117/c-Kit Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd117-c-kit-protein-mouse-hek293-his.html

Purity

95.0

Smiles

SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHT

Molecular Formula

16590 (Gene_ID) P05532-1 (S25-T523) (Accession)

Molecular Weight

70-80 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Nfu1 (NM_001170591) Mouse Tagged ORF Clone Lentiviral Particle
MR218851L3V 200 µL

Nfu1 (NM_001170591) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
CLASP1 (CLIP-associating Protein 1, Cytoplasmic Linker-associated Protein 1, Multiple Asters Homolog 1, Protein Orbit Homolog 1, hOrbit1, KIAA0622, MAST1) APC
MBS6135922-01 0.1 mL

CLASP1 (CLIP-associating Protein 1, Cytoplasmic Linker-associated Protein 1, Multiple Asters Homolog 1, Protein Orbit Homolog 1, hOrbit1, KIAA0622, MAST1) APC

Ask
View Details
CLASP1 (CLIP-associating Protein 1, Cytoplasmic Linker-associated Protein 1, Multiple Asters Homolog 1, Protein Orbit Homolog 1, hOrbit1, KIAA0622, MAST1) APC
MBS6135922-02 5x 0.1 mL

CLASP1 (CLIP-associating Protein 1, Cytoplasmic Linker-associated Protein 1, Multiple Asters Homolog 1, Protein Orbit Homolog 1, hOrbit1, KIAA0622, MAST1) APC

Ask
View Details
Mouse Trap1 (NM_026508) AAV Particle
MR210158A1V 250 µL

Mouse Trap1 (NM_026508) AAV Particle

Ask
View Details
AASDHPPT (L-aminoadipate-semialdehyde Dehydrogenase-phosphopantetheinyl Transferase) (FITC)
322040-01 50 µg

AASDHPPT (L-aminoadipate-semialdehyde Dehydrogenase-phosphopantetheinyl Transferase) (FITC)

Ask
View Details
AASDHPPT (L-aminoadipate-semialdehyde Dehydrogenase-phosphopantetheinyl Transferase) (FITC)
322040-02 100 µg

AASDHPPT (L-aminoadipate-semialdehyde Dehydrogenase-phosphopantetheinyl Transferase) (FITC)

Ask
View Details