Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD117/c-Kit, Mouse (HEK293, His)

CD117/c-Kit protein is a tyrosine protein kinase that acts as a cell surface receptor for KITLG/SCF and regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, function, and melanogenesis .CD117/c-Kit Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD117/c-Kit protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

CD117/c-Kit Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd117-c-kit-protein-mouse-hek293-his.html

Purity

95.0

Smiles

SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHT

Molecular Formula

16590 (Gene_ID) P05532-1 (S25-T523) (Accession)

Molecular Weight

70-80 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Pelotomaculum thermopropionicum UPF0756 membrane protein PTH_1668 (PTH_1668), partial
MBS7064501 Inquire

Recombinant Pelotomaculum thermopropionicum UPF0756 membrane protein PTH_1668 (PTH_1668), partial

Ask
View Details
AVPR1B, CT (AVPR1B, AVPR3, VPR3, Vasopressin V1b receptor, AVPR V1b, AVPR V3, Antidiuretic hormone receptor 1b, Vasopressin V3 receptor) (FITC)
032337-FITC 200 µL

AVPR1B, CT (AVPR1B, AVPR3, VPR3, Vasopressin V1b receptor, AVPR V1b, AVPR V3, Antidiuretic hormone receptor 1b, Vasopressin V3 receptor) (FITC)

Ask
View Details
Pigeon Zeatin Riboside (ZR) ELISA Kit
MBS9354213 Inquire

Pigeon Zeatin Riboside (ZR) ELISA Kit

Ask
View Details
Mouse Anti-Human IL2RA monoclonal antibody, clone C-H4
CABT-L875M 200 μg

Mouse Anti-Human IL2RA monoclonal antibody, clone C-H4

Ask
View Details