Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLDIP3 Peptide - C-terminal region

POLDIP3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA1649, PDIP46, SKAR

UniProt

Q9BY77

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POLDIP3 Rabbit Polyclonal Antibody (orb577880) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_835237

Preservative

Lyophilized powder

AA Sequence

LLRLSDSPSMKKESELPRRVNSASSSNPPAEVDPDTILKALFKSSGASVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYBC1 (NM_001100408) Human Over-expression Lysate
LC420252 20 µg

CYBC1 (NM_001100408) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Bves activation kit by CRISPRa
GA204769 1 Kit

Mouse Bves activation kit by CRISPRa

Sign In for Pricing
View Details
Amplite® Fluorimetric Extracellular Nitric Oxide (NO) Activity Assay Kit
16365-AAT 100 Tests

Amplite® Fluorimetric Extracellular Nitric Oxide (NO) Activity Assay Kit

Sign In for Pricing
View Details
ADCY3 Rabbit Polyclonal Antibody
TA368990 100 µL

ADCY3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Macrophage Inflammatory Protein 1 Beta (MIP1b) ELISA Kit
RD-MIP1b-Hu-01 96 Tests

Human Macrophage Inflammatory Protein 1 Beta (MIP1b) ELISA Kit

Sign In for Pricing
View Details
Human Macrophage Inflammatory Protein 1 Beta (MIP1b) ELISA Kit
RD-MIP1b-Hu-02 48 Tests

Human Macrophage Inflammatory Protein 1 Beta (MIP1b) ELISA Kit

Sign In for Pricing
View Details