Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLDIP3 Peptide - C-terminal region

POLDIP3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA1649, PDIP46, SKAR

UniProt

Q9BY77

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POLDIP3 Rabbit Polyclonal Antibody (orb577880) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_835237

Preservative

Lyophilized powder

AA Sequence

LLRLSDSPSMKKESELPRRVNSASSSNPPAEVDPDTILKALFKSSGASVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS705828 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
CD3e, Mouse (145-2C11), CF405S conjugate, 0.1mg/mL
BNC042013-100 1x 100 µL

CD3e, Mouse (145-2C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Canagliflozin Dimer
TRC-C175225-1MG 1 mg

Canagliflozin Dimer

Sign In for Pricing
View Details
2,5-Bis(2,2,2-trifluoroethoxy)benzoic Acid-d4
TRC-B585488-5MG 5 mg

2,5-Bis(2,2,2-trifluoroethoxy)benzoic Acid-d4

Sign In for Pricing
View Details
EIF4A2 Polyclonal Antibody
E-AB-19148-01 20 µL

EIF4A2 Polyclonal Antibody

Sign In for Pricing
View Details
EIF4A2 Polyclonal Antibody
E-AB-19148-02 60 µL

EIF4A2 Polyclonal Antibody

Sign In for Pricing
View Details