Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppargc1a Peptide - C-terminal region

Ppargc1a Peptide - C-terminal region

Product Specifications

Product Name Alternative

A830037N07Rik, PGC-1, PGC-1v, Pgc-1alpha, Pgc1, Pgco1, Ppargc1, Gm11133, ENSMUSG00000079510

UniProt

O70343

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ppargc1a Rabbit Polyclonal Antibody (orb330035) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032930

Preservative

Lyophilized powder

AA Sequence

LENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRPS2 sgRNA CRISPR Lentivector (Human) (Target 2)
K1729503 1.0 µg DNA

PRPS2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human ICA1L Pre-designed siRNA Set A
SI007396A 1 Each

Human ICA1L Pre-designed siRNA Set A

Sign In for Pricing
View Details
OKRC00951-96W - TIM-4 ELISA Kit (Human)
OKRC00951-96W 96 Well

OKRC00951-96W - TIM-4 ELISA Kit (Human)

Sign In for Pricing
View Details
ABL1 Antibody, HRP conjugated
CSB-PA04355B0Rb-01 50 µg

ABL1 Antibody, HRP conjugated

Sign In for Pricing
View Details
ABL1 Antibody, HRP conjugated
CSB-PA04355B0Rb-02 100 µg

ABL1 Antibody, HRP conjugated

Sign In for Pricing
View Details
pUC57-E(2019-nCoV) Plasmid
PVT23103 2 µg

pUC57-E(2019-nCoV) Plasmid

Sign In for Pricing
View Details