Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppargc1a Peptide - C-terminal region

Ppargc1a Peptide - C-terminal region

Product Specifications

Product Name Alternative

A830037N07Rik, PGC-1, PGC-1v, Pgc-1alpha, Pgc1, Pgco1, Ppargc1, Gm11133, ENSMUSG00000079510

UniProt

O70343

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ppargc1a Rabbit Polyclonal Antibody (orb330035) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032930

Preservative

Lyophilized powder

AA Sequence

LENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRIN2A Polyclonal Antibody
A52916-020 20 µL

GRIN2A Polyclonal Antibody

Sign In for Pricing
View Details
RAC-Beta Serine/Threonine-Protein Kinase (AKT2) Antibody
abx455147-01 50 µg

RAC-Beta Serine/Threonine-Protein Kinase (AKT2) Antibody

Sign In for Pricing
View Details
RAC-Beta Serine/Threonine-Protein Kinase (AKT2) Antibody
abx455147-02 100 µg

RAC-Beta Serine/Threonine-Protein Kinase (AKT2) Antibody

Sign In for Pricing
View Details
Vangl1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4336708 1.0 µg DNA

Vangl1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Glucoarabin
MBS5823957 Inquire

Glucoarabin

Sign In for Pricing
View Details
Recombinant Human Siglec-2 Protein
RP01101 50 µg

Recombinant Human Siglec-2 Protein

Sign In for Pricing
View Details