Ppp1r1a Peptide - N-terminal region
Ppp1r1a Peptide - N-terminal region
Product Specifications
Product Name Alternative
0610038N18Rik, I-1
UniProt
Q9ERT9
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ppp1r1a Rabbit Polyclonal Antibody (orb578422) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_067366
Preservative
Lyophilized powder
AA Sequence
FTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNSLLK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740676-100 1x 100 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042115-500 1x 500 µL
Cytokeratin 8 (KRT8) (KRT8/2115), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details