Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRAP1 Peptide - C-terminal region

PRAP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC126792, PRO1195, RP11-122K13.6, UPA

UniProt

Q96NZ9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRAP1 Rabbit Polyclonal Antibody (orb326261) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033413

Preservative

Lyophilized powder

AA Sequence

VLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0759 (AF_0759)
MBS7036414-01 0.02 mg

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0759 (AF_0759)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0759 (AF_0759)
MBS7036414-02 0.1 mg

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0759 (AF_0759)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0759 (AF_0759)
MBS7036414-03 5x 0.1 mg

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0759 (AF_0759)

Sign In for Pricing
View Details
Rnaset2a Mouse Gene Knockout Kit (CRISPR)
KN514880 1 Kit

Rnaset2a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DHRS11, ID (DHRS11, Dehydrogenase/reductase SDR family member 11) (MaxLight 550) discontinued
034615-ML550 100 µL

DHRS11, ID (DHRS11, Dehydrogenase/reductase SDR family member 11) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Rabbit anti-Homo sapiens (Human) GABRP Polyclonal Antibody
MBS7139342 Inquire

Rabbit anti-Homo sapiens (Human) GABRP Polyclonal Antibody

Sign In for Pricing
View Details