Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRAP1 Peptide - C-terminal region

PRAP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC126792, PRO1195, RP11-122K13.6, UPA

UniProt

Q96NZ9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRAP1 Rabbit Polyclonal Antibody (orb326261) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033413

Preservative

Lyophilized powder

AA Sequence

VLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal LONP2 Antibody
APR05633G 0.1ml

Polyclonal LONP2 Antibody

Sign In for Pricing
View Details
GSK481 100mg
A12615-100 100 mg

GSK481 100mg

Sign In for Pricing
View Details
RING Finger Protein 113B (RNF113B, bA10G5.1, RNF161, Zinc Finger Protein 183-like 1, ZNF183L1) (Not for Export EU)
132634 100 µL

RING Finger Protein 113B (RNF113B, bA10G5.1, RNF161, Zinc Finger Protein 183-like 1, ZNF183L1) (Not for Export EU)

Sign In for Pricing
View Details
AF488 Anti-Human CD44 Antibody
MBS4516084-01 20 Tests

AF488 Anti-Human CD44 Antibody

Sign In for Pricing
View Details
AF488 Anti-Human CD44 Antibody
MBS4516084-02 50 Tests

AF488 Anti-Human CD44 Antibody

Sign In for Pricing
View Details
AF488 Anti-Human CD44 Antibody
MBS4516084-03 100 Tests

AF488 Anti-Human CD44 Antibody

Sign In for Pricing
View Details