Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prkch Peptide - C-terminal region

Prkch Peptide - C-terminal region

Product Specifications

Product Name Alternative

Pkch

UniProt

P23298

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prkch Rabbit Polyclonal Antibody (orb583274) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032882

Preservative

Lyophilized powder

AA Sequence

TPDYIAPEILQEMLYGPAVDWWAMGVLLYEMLCGHAPFEAENEDDLFEAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken cytokinin MB (CK-MB) ELISA Kit
EIA05488Ch 1 Kit

Chicken cytokinin MB (CK-MB) ELISA Kit

Sign In for Pricing
View Details
Adat3 (m) -PR
sc-140873-PR 10 µM - 20 µL

Adat3 (m) -PR

Sign In for Pricing
View Details
Human IL-22 ELISA Kit (Colorimetric)
NBP1-84817 96 Tests

Human IL-22 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
Camel Syncoilin ELISA Kit
MBS086755-01 48 Well

Camel Syncoilin ELISA Kit

Sign In for Pricing
View Details
Camel Syncoilin ELISA Kit
MBS086755-02 96 Well

Camel Syncoilin ELISA Kit

Sign In for Pricing
View Details
Camel Syncoilin ELISA Kit
MBS086755-03 5x 96 Well

Camel Syncoilin ELISA Kit

Sign In for Pricing
View Details