Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrx2 Peptide - N-terminal region

Prrx2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Prx2, S8

UniProt

Q06348

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prrx2 Rabbit Polyclonal Antibody (orb576161) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033142

Preservative

Lyophilized powder

AA Sequence

DPPAPGPGPPPAPGDCAQARKNFSVSHLLDLEEVAAAGRRAAGPVSGPAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Moesin (MSN) Mouse Monoclonal Antibody [Clone ID: 2C12]
AM06738PU-N 100 µg

Moesin (MSN) Mouse Monoclonal Antibody [Clone ID: 2C12]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Maackia amurensis Lectin -MAA-,  10nm
GP-7801-10 1 mL

Colloidal Gold Conjugated Maackia amurensis Lectin -MAA-, 10nm

Sign In for Pricing
View Details
Human PHF10 activation kit by CRISPRa
GA110662 1 Kit

Human PHF10 activation kit by CRISPRa

Sign In for Pricing
View Details
TAF11 Polyclonal Antibody
E-AB-67930-01 60 µL

TAF11 Polyclonal Antibody

Sign In for Pricing
View Details
TAF11 Polyclonal Antibody
E-AB-67930-02 120 µL

TAF11 Polyclonal Antibody

Sign In for Pricing
View Details
TAF11 Polyclonal Antibody
E-AB-67930-03 200 µL

TAF11 Polyclonal Antibody

Sign In for Pricing
View Details