Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrx2 Peptide - N-terminal region

Prrx2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Prx2, S8

UniProt

Q06348

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prrx2 Rabbit Polyclonal Antibody (orb576161) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033142

Preservative

Lyophilized powder

AA Sequence

DPPAPGPGPPPAPGDCAQARKNFSVSHLLDLEEVAAAGRRAAGPVSGPAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mannan Binding Lectin (MBL2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A12]
TA507147AM 100 µL

Mannan Binding Lectin (MBL2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A12]

Sign In for Pricing
View Details
IFIT1 (NM_001548) Human Over-expression Lysate
LC400592 20 µg

IFIT1 (NM_001548) Human Over-expression Lysate

Sign In for Pricing
View Details
RBBP5 Antibody
KC-6187-01 50 μL

RBBP5 Antibody

Sign In for Pricing
View Details
RBBP5 Antibody
KC-6187-02 100 µL

RBBP5 Antibody

Sign In for Pricing
View Details
RBBP5 Antibody
KC-6187-03 1 mL

RBBP5 Antibody

Sign In for Pricing
View Details
NONO (NM_001145410) Human Over-expression Lysate
LC428869 20 µg

NONO (NM_001145410) Human Over-expression Lysate

Sign In for Pricing
View Details