Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSCA Peptide - C-terminal region

PSCA Peptide - C-terminal region

Product Specifications

Product Name Alternative

PRO232

UniProt

O43653

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSCA Rabbit Polyclonal Antibody (orb578401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005663

Preservative

Lyophilized powder

AA Sequence

TVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (3-Carboxyphenyl) thiophene
sc-259172 1 g

2- (3-Carboxyphenyl) thiophene

Sign In for Pricing
View Details
Mouse LRG1 ELISA Kit
orb440613-01 48 Tests

Mouse LRG1 ELISA Kit

Sign In for Pricing
View Details
Mouse LRG1 ELISA Kit
orb440613-02 96 Tests

Mouse LRG1 ELISA Kit

Sign In for Pricing
View Details
BTK (NM_000061) Human Mutant ORF Clone
RC401016 10 µg

BTK (NM_000061) Human Mutant ORF Clone

Sign In for Pricing
View Details
N4- (1-Phenylethyl) quinazoline-2,4-diamine
BKC15614-01 50 mg

N4- (1-Phenylethyl) quinazoline-2,4-diamine

Sign In for Pricing
View Details
N4- (1-Phenylethyl) quinazoline-2,4-diamine
BKC15614-02 0.5 g

N4- (1-Phenylethyl) quinazoline-2,4-diamine

Sign In for Pricing
View Details