Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSCA Peptide - C-terminal region

PSCA Peptide - C-terminal region

Product Specifications

Product Name Alternative

PRO232

UniProt

O43653

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSCA Rabbit Polyclonal Antibody (orb578401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005663

Preservative

Lyophilized powder

AA Sequence

TVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASA3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
38525154 3x 1.0 µg DNA

RASA3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
CEP290 Human shRNA Lentiviral Particle (Locus ID 80184)
TL305438V 500 µL Each

CEP290 Human shRNA Lentiviral Particle (Locus ID 80184)

Sign In for Pricing
View Details
SEMA3G Mouse Monoclonal Antibody [Clone ID: LBI8B10]
AMM20217V 100 µL

SEMA3G Mouse Monoclonal Antibody [Clone ID: LBI8B10]

Sign In for Pricing
View Details
Goat CCehemokine ligand1 (CCL1) ELISA Kit
EIA05445Go 1 Kit

Goat CCehemokine ligand1 (CCL1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Rickettsia rickettsii Glutamate--tRNA ligase 2 (gltX2), partial
MBS1222829 Inquire

Recombinant Rickettsia rickettsii Glutamate--tRNA ligase 2 (gltX2), partial

Sign In for Pricing
View Details
HER3 Protein (C-Human Fc tag, )
P511507 100 µg

HER3 Protein (C-Human Fc tag, )

Sign In for Pricing
View Details