PSMD12 Peptide - middle region
PSMD12 Peptide - middle region
Product Specifications
Product Name Alternative
MGC75406, p55, Rpn5
UniProt
Q5RBI3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PSMD12 Rabbit Polyclonal Antibody (orb583739) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002807
Preservative
Lyophilized powder
AA Sequence
KYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15110857 1 Vial
Lentiviral human SVEP1 shRNA (UAS) - Lentiviral human SVEP1 shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details GTR15362549 1 Vial
Lentiviral human UPP2 sgRNA gene knockout kit - Lentiviral human UPP2 sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details ![(6R,10R) -tert-Butyl 3-Oxo-2,3,6,7,9,10-hexahydro-6,10-methano[1,2,4]triazolo[4,3-a][1,5]diazocine-8 (5H) -carboxylate](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
439076-01 5 mg
(6R,10R) -tert-Butyl 3-Oxo-2,3,6,7,9,10-hexahydro-6,10-methano[1,2,4]triazolo[4,3-a][1,5]diazocine-8 (5H) -carboxylate
Sign In for Pricing
View Details 439076-02 50 mg
(6R,10R) -tert-Butyl 3-Oxo-2,3,6,7,9,10-hexahydro-6,10-methano[1,2,4]triazolo[4,3-a][1,5]diazocine-8 (5H) -carboxylate
Sign In for Pricing
View Details