Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD12 Peptide - middle region

PSMD12 Peptide - middle region

Product Specifications

Product Name Alternative

MGC75406, p55, Rpn5

UniProt

Q5RBI3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMD12 Rabbit Polyclonal Antibody (orb583739) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002807

Preservative

Lyophilized powder

AA Sequence

KYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PURA sgRNA gene knockout kit - Lentiviral human PURA sgRNA gene knockout kit (25)
GTR15389277 1 Vial

Lentiviral human PURA sgRNA gene knockout kit - Lentiviral human PURA sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
ACSL1 polyclonal antibody
orb1720154-01 50 µL

ACSL1 polyclonal antibody

Sign In for Pricing
View Details
ACSL1 polyclonal antibody
orb1720154-02 100 µL

ACSL1 polyclonal antibody

Sign In for Pricing
View Details
Human TUBGCP4 Protein Lysate
MBS8429341-01 0.02 mg

Human TUBGCP4 Protein Lysate

Sign In for Pricing
View Details
Human TUBGCP4 Protein Lysate
MBS8429341-02 5x 0.02 mg

Human TUBGCP4 Protein Lysate

Sign In for Pricing
View Details
Human DCX Monoclonal Antibody
orb3152589-01 50 µg

Human DCX Monoclonal Antibody

Sign In for Pricing
View Details