Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPRR Peptide - N-terminal region

PTPRR Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp781C1038, EC-PTP, FLJ34328, MGC131968, MGC148170, PCPTP1, PTP-SL, PTPBR7, PTPRQ

UniProt

Q2TAJ3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTPRR Rabbit Polyclonal Antibody (orb579450) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_570897

Preservative

Lyophilized powder

AA Sequence

NIEPFVSIPTPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to PAI-1/tPA Complex (tPA/PAI1)
TRV-0048132-01 20 µL

Monoclonal Antibody to PAI-1/tPA Complex (tPA/PAI1)

Sign In for Pricing
View Details
Monoclonal Antibody to PAI-1/tPA Complex (tPA/PAI1)
TRV-0048132-02 100 µL

Monoclonal Antibody to PAI-1/tPA Complex (tPA/PAI1)

Sign In for Pricing
View Details
Monoclonal Antibody to PAI-1/tPA Complex (tPA/PAI1)
TRV-0048132-03 200 µL

Monoclonal Antibody to PAI-1/tPA Complex (tPA/PAI1)

Sign In for Pricing
View Details
Monoclonal Antibody to PAI-1/tPA Complex (tPA/PAI1)
TRV-0048132-04 1 mL

Monoclonal Antibody to PAI-1/tPA Complex (tPA/PAI1)

Sign In for Pricing
View Details
PREP siRNA (Human)
CRH3726-01 15 nmol

PREP siRNA (Human)

Sign In for Pricing
View Details
PREP siRNA (Human)
CRH3726-02 30 nmol

PREP siRNA (Human)

Sign In for Pricing
View Details