Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pygm Peptide - C-terminal region

Pygm Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI115133, PG

UniProt

Q9WUB3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pygm Rabbit Polyclonal Antibody (orb580483) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035354

Preservative

Lyophilized powder

AA Sequence

KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human, Pig Adrenomedullin (16-31) peptide
orb1090696 5 mg

Human, Pig Adrenomedullin (16-31) peptide

Sign In for Pricing
View Details
Lentiviral human ZNF705A shRNA (UAS) - Lentiviral human ZNF705A shRNA (UAS) (100)
GTR15328677 1 Vial

Lentiviral human ZNF705A shRNA (UAS) - Lentiviral human ZNF705A shRNA (UAS) (100)

Sign In for Pricing
View Details
SGSM1 siRNA (Mouse)
CRM5321-01 15 nmol

SGSM1 siRNA (Mouse)

Sign In for Pricing
View Details
SGSM1 siRNA (Mouse)
CRM5321-02 30 nmol

SGSM1 siRNA (Mouse)

Sign In for Pricing
View Details
β-Hydroxybutyrate (β-HB) Colorimetric Assay Kit
K2136-100 100 Assays

β-Hydroxybutyrate (β-HB) Colorimetric Assay Kit

Sign In for Pricing
View Details
P-NH2-Bn-PCTA hydrochloride
orb2942047-01 100 mg

P-NH2-Bn-PCTA hydrochloride

Sign In for Pricing
View Details