Pygm Peptide - C-terminal region
Pygm Peptide - C-terminal region
Product Specifications
Product Name Alternative
AI115133, PG
UniProt
Q9WUB3
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Pygm Rabbit Polyclonal Antibody (orb580483) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_035354
Preservative
Lyophilized powder
AA Sequence
KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEKI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401775-100 1x 100 µL
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUB2181-100 1x 100 µL
Occludin (Marker of Early Blood Brain Barrier Damage) (OCLN/2181), 0.2mg/mL
Sign In for Pricing
View Details 
BNC941692-100 1x 100 µL
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-UNEL-M0172-01 5x 96 Tests
Uncoated Mouse SLC (Secondary Lymphoid Tissue Chemokine) ELISA Kit
Sign In for Pricing
View Details E-UNEL-M0172-02 15x 96 Tests
Uncoated Mouse SLC (Secondary Lymphoid Tissue Chemokine) ELISA Kit
Sign In for Pricing
View Details