Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAP1GDS1 Peptide - middle region

RAP1GDS1 Peptide - middle region

Product Specifications

Product Name Alternative

GDS1, MGC118859, MGC118861, SmgGDS

UniProt

P52306

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAP1GDS1 Rabbit Polyclonal Antibody (orb584404) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001093899

Preservative

Lyophilized powder

AA Sequence

LLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MICB Protein
E30P866 20 µg

Recombinant Human MICB Protein

Sign In for Pricing
View Details
EML1 antibody
MBS9403795-01 0.1 mL

EML1 antibody

Sign In for Pricing
View Details
EML1 antibody
MBS9403795-02 5x 0.1 mL

EML1 antibody

Sign In for Pricing
View Details
TMLHE Polyclonal Conjugated Antibody
orb1626241 100 µL

TMLHE Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Phospho-FADD (Ser191) Rabbit Polyclonal Antibody
orb6030-01 50 μL

Phospho-FADD (Ser191) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-FADD (Ser191) Rabbit Polyclonal Antibody
orb6030-02 100 µL

Phospho-FADD (Ser191) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details