Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAP1GDS1 Peptide - middle region

RAP1GDS1 Peptide - middle region

Product Specifications

Product Name Alternative

GDS1, MGC118859, MGC118861, SmgGDS

UniProt

P52306

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAP1GDS1 Rabbit Polyclonal Antibody (orb584404) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001093899

Preservative

Lyophilized powder

AA Sequence

LLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Skp2 Antibody [DyLight 350]
NBP2-97674UV 0.1 mL

Rabbit Polyclonal Skp2 Antibody [DyLight 350]

Sign In for Pricing
View Details
MSHR Antibody, mAb, Rabbit
A04772-50 50 µL

MSHR Antibody, mAb, Rabbit

Sign In for Pricing
View Details
GALNAC4S-6ST AAV Vector (Human) (CMV)
21213101 1 µg

GALNAC4S-6ST AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Pigment Red 53
HY-117964 1 Each

Pigment Red 53

Sign In for Pricing
View Details
L-Methionine-15N
OR1032016 1 Each

L-Methionine-15N

Sign In for Pricing
View Details
Selp (NM_011347) Mouse Recombinant Protein
TP526764 20 µg

Selp (NM_011347) Mouse Recombinant Protein

Sign In for Pricing
View Details