Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rffl Peptide - N-terminal region

Rffl Peptide - N-terminal region

Product Specifications

Product Name Alternative

1700051E09Rik, 4930516L10Rik, BG080975, Carp2, MGC144763

UniProt

Q3TEV8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rffl Rabbit Polyclonal Antibody (orb578671) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001158043

Preservative

Lyophilized powder

AA Sequence

MWASCCNWFCLDGQPEEAPPPQGARTQAYSNPGYSSFPSPTGSEPSCKAC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ybx2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3974502 1.0 µg DNA

Ybx2 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
UQCRB Rabbit pAb (APR19352N)
APR19352N-01 50 µL

UQCRB Rabbit pAb (APR19352N)

Sign In for Pricing
View Details
UQCRB Rabbit pAb (APR19352N)
APR19352N-02 100 µL

UQCRB Rabbit pAb (APR19352N)

Sign In for Pricing
View Details
UQCRB Rabbit pAb (APR19352N)
APR19352N-03 200 µL

UQCRB Rabbit pAb (APR19352N)

Sign In for Pricing
View Details
Importin-8 (C-5) HRP
sc-398854 HRP 200 µg/mL

Importin-8 (C-5) HRP

Sign In for Pricing
View Details
Atp5h 3'UTR Lenti-reporter-Luc Vector
12738084 1.0 µg

Atp5h 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details