Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rffl Peptide - N-terminal region

Rffl Peptide - N-terminal region

Product Specifications

Product Name Alternative

1700051E09Rik, 4930516L10Rik, BG080975, Carp2, MGC144763

UniProt

Q3TEV8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rffl Rabbit Polyclonal Antibody (orb578671) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001158043

Preservative

Lyophilized powder

AA Sequence

MWASCCNWFCLDGQPEEAPPPQGARTQAYSNPGYSSFPSPTGSEPSCKAC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Research Grade Anti-Human SERPINE1/PAI-1 (CT140)
HY185026-01 100 µg

Research Grade Anti-Human SERPINE1/PAI-1 (CT140)

Sign In for Pricing
View Details
Research Grade Anti-Human SERPINE1/PAI-1 (CT140)
HY185026-02 1 mg

Research Grade Anti-Human SERPINE1/PAI-1 (CT140)

Sign In for Pricing
View Details
NOC4L Antibody
orb2636888 100 µg

NOC4L Antibody

Sign In for Pricing
View Details
Phospho-PKC δ (Thr505) ELISA Kit
EKA51212 192 Tests

Phospho-PKC δ (Thr505) ELISA Kit

Sign In for Pricing
View Details
Rabbit QSOX2 Antibody
orb1522919-01 10 µL

Rabbit QSOX2 Antibody

Sign In for Pricing
View Details
Rabbit QSOX2 Antibody
orb1522919-02 100 µL

Rabbit QSOX2 Antibody

Sign In for Pricing
View Details