RIT1 Peptide - middle region
RIT1 Peptide - middle region
Product Specifications
Product Name Alternative
MGC125864, MGC125865, RIBB, RIT, ROC1
UniProt
Q92963
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RIT1 Rabbit Polyclonal Antibody (orb585113) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_008843
Preservative
Lyophilized powder
AA Sequence
FHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2852805 100 µL
Phospho-GSK-3 Beta (Ser9) Rabbit pAb, Pacific Blue conjugated
Sign In for Pricing
View Details 
MBS1341805-01 0.02 mg (E-Coli)
Recombinant Salmonella paratyphi A Succinylornithine transaminase (astC)
Sign In for Pricing
View Details MBS1341805-02 0.02 mg (Yeast)
Recombinant Salmonella paratyphi A Succinylornithine transaminase (astC)
Sign In for Pricing
View Details MBS1341805-03 0.1 mg (E-Coli)
Recombinant Salmonella paratyphi A Succinylornithine transaminase (astC)
Sign In for Pricing
View Details