Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIT1 Peptide - middle region

RIT1 Peptide - middle region

Product Specifications

Product Name Alternative

MGC125864, MGC125865, RIBB, RIT, ROC1

UniProt

Q92963

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RIT1 Rabbit Polyclonal Antibody (orb585113) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008843

Preservative

Lyophilized powder

AA Sequence

FHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Apolipoprotein H (Apo-H) ELISA Kit
MBS2608817-01 48 Well

Bovine Apolipoprotein H (Apo-H) ELISA Kit

Sign In for Pricing
View Details
Bovine Apolipoprotein H (Apo-H) ELISA Kit
MBS2608817-02 96 Well

Bovine Apolipoprotein H (Apo-H) ELISA Kit

Sign In for Pricing
View Details
Bovine Apolipoprotein H (Apo-H) ELISA Kit
MBS2608817-03 5x 96 Well

Bovine Apolipoprotein H (Apo-H) ELISA Kit

Sign In for Pricing
View Details
Bovine Apolipoprotein H (Apo-H) ELISA Kit
MBS2608817-04 10x 96 Well

Bovine Apolipoprotein H (Apo-H) ELISA Kit

Sign In for Pricing
View Details
Innovative Grade US Origin Porcine Prostate With Urethra Fresh
IGPCPSTFT4 1 Each

Innovative Grade US Origin Porcine Prostate With Urethra Fresh

Sign In for Pricing
View Details
Cinacalcet-d4 Hydrochloride
444560 1 mg

Cinacalcet-d4 Hydrochloride

Sign In for Pricing
View Details