Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rnf166 Peptide - middle region

Rnf166 Peptide - middle region

Product Specifications

Product Name Alternative

1110031E24Rik, AW555115, Zfp313l

UniProt

Q3U9F6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rnf166 Rabbit Polyclonal Antibody (orb574064) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028314

Preservative

Lyophilized powder

AA Sequence

PLCRLPFDPKKVDKATHVEKQLSSYKAPCRGCNKKVTLAKMRAHISSCLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal LMNTD2 Antibody
NBP2-56567-25ul 25 µL

Rabbit Polyclonal LMNTD2 Antibody

Sign In for Pricing
View Details
Recombinant Interleukin 1 Beta (IL1b)
SIPA147Po01-01 10 µg

Recombinant Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
Recombinant Interleukin 1 Beta (IL1b)
SIPA147Po01-02 50 µg

Recombinant Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
Recombinant Interleukin 1 Beta (IL1b)
SIPA147Po01-03 200 µg

Recombinant Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
Recombinant Interleukin 1 Beta (IL1b)
SIPA147Po01-04 1 mg

Recombinant Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
Recombinant Interleukin 1 Beta (IL1b)
SIPA147Po01-05 5 mg

Recombinant Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details