RP11-269F19.9 Peptide - middle region
RP11-269F19.9 Peptide - middle region
Product Specifications
Product Name Alternative
LOC343521, RP11-269F19.9
UniProt
Q5JR98
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RP11-269F19.9 Rabbit Polyclonal Antibody (orb325915) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001013654
Preservative
Lyophilized powder
AA Sequence
VCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681037-100 1x 100 µL
CD44 Standard (DF1485), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details