Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL10A Peptide - middle region

RPL10A Peptide - middle region

Product Specifications

Product Name Alternative

Csa-19, NEDD6, L10A

UniProt

P62906

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL10A Rabbit Polyclonal Antibody (orb583284) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009035

Preservative

Lyophilized powder

AA Sequence

YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calpastatin (CAST/1550), CF640R conjugate, 0.1mg/mL
BNC401550-100 1x 100 µL

Calpastatin (CAST/1550), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(6R,7S)-Cefoperazone Sodium Salt
TRC-C242890-5MG 5 mg

(6R,7S)-Cefoperazone Sodium Salt

Sign In for Pricing
View Details
p-Nitrophenyl 4-O-Beta-D-Mannopyranosyl-Beta-D-glucopyranoside
TRC-N504375-1MG 1 mg

p-Nitrophenyl 4-O-Beta-D-Mannopyranosyl-Beta-D-glucopyranoside

Sign In for Pricing
View Details
Cytokeratin 17 Rabbit Polyclonal Antibody
0407-4 100 µL

Cytokeratin 17 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LOXL2 Rabbit Polyclonal Antibody
TA378099 100 µL

LOXL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD64 (10.1), CF594 conjugate, 0.1mg/mL
BNC942846-100 1x 100 µL

CD64 (10.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details