Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL10A Peptide - middle region

RPL10A Peptide - middle region

Product Specifications

Product Name Alternative

Csa-19, NEDD6, L10A

UniProt

P62906

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL10A Rabbit Polyclonal Antibody (orb583284) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009035

Preservative

Lyophilized powder

AA Sequence

YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human AGO2/Argonaute 2/EIF2C2 Protein (His Tag)
PKSH031271-01 100 µg

Recombinant Human AGO2/Argonaute 2/EIF2C2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human AGO2/Argonaute 2/EIF2C2 Protein (His Tag)
PKSH031271-02 1 mg

Recombinant Human AGO2/Argonaute 2/EIF2C2 Protein (His Tag)

Sign In for Pricing
View Details
Maltose Binding Protein / MBP-probe (R29.6), CF647 conjugate, 0.1mg/mL
BNC472847-100 1x 100 µL

Maltose Binding Protein / MBP-probe (R29.6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CEP63 (NM_001042384) Human Over-expression Lysate
LY420863 100 µg

CEP63 (NM_001042384) Human Over-expression Lysate

Sign In for Pricing
View Details
2-(2-Cyanophenyl)benzonitrile
TRC-C989863-50MG 50 mg

2-(2-Cyanophenyl)benzonitrile

Sign In for Pricing
View Details
Acetyl CoA synthetase (ACSS2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B12]
TA503612BM 100 µL

Acetyl CoA synthetase (ACSS2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B12]

Sign In for Pricing
View Details