Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS4Y1 Peptide - C-terminal region

RPS4Y1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC119100, MGC5070, RPS4Y, S4

UniProt

P22090

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS4Y1 Rabbit Polyclonal Antibody (orb585271) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000999

Preservative

Lyophilized powder

AA Sequence

NGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human Neutrophil NFPRb
Y300143 100 µg

Anti-Human Neutrophil NFPRb

Sign In for Pricing
View Details
Cidec Protein Vector (Rat) (pPB-N-His)
PV260095 500 ng

Cidec Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Elastin (ELN)
MBS2091055-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Elastin (ELN)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Elastin (ELN)
MBS2091055-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Elastin (ELN)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Elastin (ELN)
MBS2091055-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Elastin (ELN)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Elastin (ELN)
MBS2091055-04 1 mL

Biotin-Linked Monoclonal Antibody to Elastin (ELN)

Sign In for Pricing
View Details