Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS4Y1 Peptide - C-terminal region

RPS4Y1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC119100, MGC5070, RPS4Y, S4

UniProt

P22090

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS4Y1 Rabbit Polyclonal Antibody (orb585271) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000999

Preservative

Lyophilized powder

AA Sequence

NGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Amino-2-trifluoromethylbenzonitrile
14856487-01 1 g

4-Amino-2-trifluoromethylbenzonitrile

Sign In for Pricing
View Details
4-Amino-2-trifluoromethylbenzonitrile
14856487-02 5 g

4-Amino-2-trifluoromethylbenzonitrile

Sign In for Pricing
View Details
NativeExtract™ Human GPR160 Membrane Protein (Full length, Super Nanodisc)
S01YF-1023-KX236 10 μg

NativeExtract™ Human GPR160 Membrane Protein (Full length, Super Nanodisc)

Sign In for Pricing
View Details
HGD (NM_000187) Human Recombinant Protein
TP310009M 100 µg

HGD (NM_000187) Human Recombinant Protein

Sign In for Pricing
View Details
Porcine Sugar phosphate exchanger 3 (SLC37A3) ELISA Kit
GTR10325547 96 Well

Porcine Sugar phosphate exchanger 3 (SLC37A3) ELISA Kit

Sign In for Pricing
View Details
Influenza A Nonstructural Protein 1 Antibody, AbBy Fluor™ 555 Conjugated
bs-4839R-BF555 100 µL

Influenza A Nonstructural Protein 1 Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details