Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSAD1 Peptide - middle region

RSAD1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ11164, FLJ20975

UniProt

Q9HA92

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RSAD1 Rabbit Polyclonal Antibody (orb583489) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060816

Preservative

Lyophilized powder

AA Sequence

NWTYWQCGQYLGVGPGAHGRFMPQGAGGHTREARIQTLEPDNWMKEVMLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD14 Antibody
orb1252608 100 µg

CD14 Antibody

Sign In for Pricing
View Details
CD33 Antibody
orb1320731-01 30 µL

CD33 Antibody

Sign In for Pricing
View Details
CD33 Antibody
orb1320731-02 50 μL

CD33 Antibody

Sign In for Pricing
View Details
CD33 Antibody
orb1320731-03 100 µL

CD33 Antibody

Sign In for Pricing
View Details
PLenti-CMV-mAifm2-GFP-Puro
PPL50285-4a 1 Each

PLenti-CMV-mAifm2-GFP-Puro

Sign In for Pricing
View Details
Recombinant Thrombomodulin (TM)
MBS2028947-01 0.01 mg

Recombinant Thrombomodulin (TM)

Sign In for Pricing
View Details