RSAD1 Peptide - middle region
RSAD1 Peptide - middle region
Product Specifications
Product Name Alternative
FLJ11164, FLJ20975
UniProt
Q9HA92
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RSAD1 Rabbit Polyclonal Antibody (orb583489) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060816
Preservative
Lyophilized powder
AA Sequence
NWTYWQCGQYLGVGPGAHGRFMPQGAGGHTREARIQTLEPDNWMKEVMLF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1490156-01 0.05 mg
Rabbit anti-mouse Hyaluronan synthase 2 polyclonal Antibody, HRP conjugated
Sign In for Pricing
View Details MBS1490156-02 0.1 mg
Rabbit anti-mouse Hyaluronan synthase 2 polyclonal Antibody, HRP conjugated
Sign In for Pricing
View Details MBS1490156-03 5x 0.1 mg
Rabbit anti-mouse Hyaluronan synthase 2 polyclonal Antibody, HRP conjugated
Sign In for Pricing
View Details 
TRV-0000880-01 20 µL
Polyclonal Antibody to Chemokine C-X3-C-Motif Ligand 1 (CX3CL1)
Sign In for Pricing
View Details TRV-0000880-02 100 µL
Polyclonal Antibody to Chemokine C-X3-C-Motif Ligand 1 (CX3CL1)
Sign In for Pricing
View Details TRV-0000880-03 200 µL
Polyclonal Antibody to Chemokine C-X3-C-Motif Ligand 1 (CX3CL1)
Sign In for Pricing
View Details