Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SATB1 Peptide - middle region

SATB1 Peptide - middle region

Product Specifications

UniProt

Q01826

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SATB1 Rabbit Polyclonal Antibody (orb574624) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002962

Preservative

Lyophilized powder

AA Sequence

EVDVAEYKEEELLKDLEESVQDKNTNTLFSVKLEEELSVEGNTDINTDLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Small COPII coat GTPase SAR1B (SAR1B)
orb3010984-01 20 µg

Recombinant Human Small COPII coat GTPase SAR1B (SAR1B)

Sign In for Pricing
View Details
Recombinant Human Small COPII coat GTPase SAR1B (SAR1B)
orb3010984-02 100 µg

Recombinant Human Small COPII coat GTPase SAR1B (SAR1B)

Sign In for Pricing
View Details
Recombinant Human Small COPII coat GTPase SAR1B (SAR1B)
orb3010984-03 1 mg

Recombinant Human Small COPII coat GTPase SAR1B (SAR1B)

Sign In for Pricing
View Details
AKR1A1 (NM_153326) Human Mass Spec Standard
PH302813 10 µg

AKR1A1 (NM_153326) Human Mass Spec Standard

Sign In for Pricing
View Details
Recombinant Human Mannose-Binding Protein C/MBL-2/MBP- C (C-6His)
C488-50ug 50 µg

Recombinant Human Mannose-Binding Protein C/MBL-2/MBP- C (C-6His)

Sign In for Pricing
View Details
Multiplex Assay Kit for Prolactin (PRL), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0027175 96 Tests

Multiplex Assay Kit for Prolactin (PRL), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details