Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SATB1 Peptide - middle region

SATB1 Peptide - middle region

Product Specifications

UniProt

Q01826

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SATB1 Rabbit Polyclonal Antibody (orb574624) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002962

Preservative

Lyophilized powder

AA Sequence

EVDVAEYKEEELLKDLEESVQDKNTNTLFSVKLEEELSVEGNTDINTDLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MCP-4
HC77724 10 µg

Human MCP-4

Sign In for Pricing
View Details
2,4-Dibromo-6-[2-(4-nitrobenzoyl)carbonohydrazonoyl]phenyl 2-bromobenzoate
TRC-D246240-50MG 50 mg

2,4-Dibromo-6-[2-(4-nitrobenzoyl)carbonohydrazonoyl]phenyl 2-bromobenzoate

Sign In for Pricing
View Details
N-Dodecyl beta-D-maltoside
C02297-100mg 100 mg

N-Dodecyl beta-D-maltoside

Sign In for Pricing
View Details
Recombinant Rhesus Macaque PHOSPHO2 Protein, His (Fc)-Avi-tagged
PHOSPHO2-3231R 50 µg

Recombinant Rhesus Macaque PHOSPHO2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Recombinant Photosystem II D2 protein (psbD)
MBS7027669-01 0.02 mg

Recombinant Photosystem II D2 protein (psbD)

Sign In for Pricing
View Details
Recombinant Photosystem II D2 protein (psbD)
MBS7027669-02 0.1 mg

Recombinant Photosystem II D2 protein (psbD)

Sign In for Pricing
View Details