Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scel Peptide - C-terminal region

Scel Peptide - C-terminal region

Product Specifications

Product Name Alternative

Scel

UniProt

Q9EQG3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Scel Rabbit Polyclonal Antibody (orb581211) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101858

Preservative

Lyophilized powder

AA Sequence

DTVVYTRTYVENSKSPKDGYQENISGKYIQTVYSTSDRSVIERDMCTYCR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leuprolide (1-3)
orb1985871-01 100 mg

Leuprolide (1-3)

Sign In for Pricing
View Details
Leuprolide (1-3)
orb1985871-02 500 mg

Leuprolide (1-3)

Sign In for Pricing
View Details
RN5S371 Protein Vector (Human) (pPB-C-His)
PV117126 500 ng

RN5S371 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
CCM2 (Malcavernin, Cerebral Cavernous Malformations 2 Protein, C7orf22, PP10187, MGC4067, MGC4607, MGC74868) discontinued
150233 100 µg

CCM2 (Malcavernin, Cerebral Cavernous Malformations 2 Protein, C7orf22, PP10187, MGC4067, MGC4607, MGC74868) discontinued

Sign In for Pricing
View Details
FCER2 Protein (N-His, Human)
P524541 100 µg

FCER2 Protein (N-His, Human)

Sign In for Pricing
View Details
Rabbit Parotid Primary Fibroblasts
CC4F214 5x 10^5 Cells/Vial

Rabbit Parotid Primary Fibroblasts

Sign In for Pricing
View Details