Scel Peptide - C-terminal region
Scel Peptide - C-terminal region
Product Specifications
Product Name Alternative
Scel
UniProt
Q9EQG3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Scel Rabbit Polyclonal Antibody (orb581211) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001101858
Preservative
Lyophilized powder
AA Sequence
DTVVYTRTYVENSKSPKDGYQENISGKYIQTVYSTSDRSVIERDMCTYCR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1173249-01 48 Tests
Xanthine Oxidase Activity Colorimetric Assay Kit
Sign In for Pricing
View Details orb1173249-02 96 Tests
Xanthine Oxidase Activity Colorimetric Assay Kit
Sign In for Pricing
View Details 
125340 50 µg
CDK12 (Cyclin-dependent Kinase 12, Cdc2-related Kinase, Arginine/Serine-rich, CrkRS, Cell Division Cycle 2-related Protein Kinase 7, CDC2-related Protein Kinase 7, Cell Division Protein Kinase 12, hCDK12, CRK7, CRKRS, KIAA0904) discontinued
Sign In for Pricing
View Details 