Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SELE Peptide - N-terminal region

SELE Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD62E, ELAM, ELAM1, ESEL, LECAM2

UniProt

P16581

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SELE Rabbit Polyclonal Antibody (orb584224) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000441

Preservative

Lyophilized powder

AA Sequence

WVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KRTAP5-10 shRNA Plasmid
abx967733-01 150 µg

Human KRTAP5-10 shRNA Plasmid

Sign In for Pricing
View Details
Human KRTAP5-10 shRNA Plasmid
abx967733-02 300 µg

Human KRTAP5-10 shRNA Plasmid

Sign In for Pricing
View Details
NEK5 (NIMA (Never in Mitosis Gene a) -related Kinase 5, MGC75495, OTTHUMP00000040896) (MaxLight 650)
207813-ML650 100 µL

NEK5 (NIMA (Never in Mitosis Gene a) -related Kinase 5, MGC75495, OTTHUMP00000040896) (MaxLight 650)

Sign In for Pricing
View Details
Lentiviral human ELSPBP1 sgRNA gene knockout kit - Lentiviral human ELSPBP1 sgRNA gene knockout kit (100)
GTR15358294 1 Vial

Lentiviral human ELSPBP1 sgRNA gene knockout kit - Lentiviral human ELSPBP1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
OCT-1 Rabbit Polyclonal Antibody (PE)
orb485791 100 µL

OCT-1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
CTPA2 Antibody
PHY2247S 150 μg

CTPA2 Antibody

Sign In for Pricing
View Details