Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERINC2 Peptide - middle region

SERINC2 Peptide - middle region

Product Specifications

Product Name Alternative

FKSG84, MGC90340, PRO0899, TDE2, TDE2L

UniProt

Q96SA4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERINC2 Rabbit Polyclonal Antibody (orb582889) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_849196

Preservative

Lyophilized powder

AA Sequence

SSIPEQKCNPHLPTQLGNETVVAGPEGYETQWWDAPSIVGLIIFLLCTLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish NFKBIAA Antibody Picoband® Fluoro647 Conjugated
AZF1QCG4-Fluoro647 100 µg/Vial

Anti-Zebrafish NFKBIAA Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
OR8B7P Protein Vector (Human) (pPM-C-HA)
PV108856 500 ng

OR8B7P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Human Synaptotagmin-15 (SYT15), partial
MBS1404370-01 0.5 mg (E-Coli)

Recombinant Human Synaptotagmin-15 (SYT15), partial

Sign In for Pricing
View Details
Recombinant Human Synaptotagmin-15 (SYT15), partial
MBS1404370-02 0.05 mg (Baculovirus)

Recombinant Human Synaptotagmin-15 (SYT15), partial

Sign In for Pricing
View Details
Recombinant Human Synaptotagmin-15 (SYT15), partial
MBS1404370-03 0.5 mg (Yeast)

Recombinant Human Synaptotagmin-15 (SYT15), partial

Sign In for Pricing
View Details
Recombinant Human Synaptotagmin-15 (SYT15), partial
MBS1404370-04 0.05 mg (Mammalian-Cell)

Recombinant Human Synaptotagmin-15 (SYT15), partial

Sign In for Pricing
View Details