SERINC2 Peptide - middle region
SERINC2 Peptide - middle region
Product Specifications
Product Name Alternative
FKSG84, MGC90340, PRO0899, TDE2, TDE2L
UniProt
Q96SA4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SERINC2 Rabbit Polyclonal Antibody (orb582889) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_849196
Preservative
Lyophilized powder
AA Sequence
SSIPEQKCNPHLPTQLGNETVVAGPEGYETQWWDAPSIVGLIIFLLCTLF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1193729-01 0.02 mg (E-Coli)
Recombinant Escherichia coli O127:H6 Bis (5'-nucleosyl) -tetraphosphatase, symmetrical
Sign In for Pricing
View Details MBS1193729-02 0.02 mg (Yeast)
Recombinant Escherichia coli O127:H6 Bis (5'-nucleosyl) -tetraphosphatase, symmetrical
Sign In for Pricing
View Details MBS1193729-03 0.1 mg (E-Coli)
Recombinant Escherichia coli O127:H6 Bis (5'-nucleosyl) -tetraphosphatase, symmetrical
Sign In for Pricing
View Details MBS1193729-04 0.1 mg (Yeast)
Recombinant Escherichia coli O127:H6 Bis (5'-nucleosyl) -tetraphosphatase, symmetrical
Sign In for Pricing
View Details MBS1193729-05 0.02 mg (Baculovirus)
Recombinant Escherichia coli O127:H6 Bis (5'-nucleosyl) -tetraphosphatase, symmetrical
Sign In for Pricing
View Details