Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF4 Peptide - C-terminal region

SF4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp434E2216, F23858, RBP, SF4

UniProt

Q8IWZ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_757386

Preservative

Lyophilized powder

AA Sequence

LGSEGQGIKNPVNKGTTTVDGAGFGIDRPAELSKEDDEYEAFRKRMMLAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scgb3a1 Mouse Gene Knockout Kit (CRISPR)
KN515369 1 Kit

Scgb3a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CRIP1 (NM_001311) Human Over-expression Lysate
LY420018 100 µg

CRIP1 (NM_001311) Human Over-expression Lysate

Sign In for Pricing
View Details
Pet1 (FEV) Human Gene Knockout Kit (CRISPR)
KN402917 1 Kit

Pet1 (FEV) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Reep4 Mouse Gene Knockout Kit (CRISPR)
KN514645 1 Kit

Reep4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GAP43 Rabbit Monoclonal Antibody [Clone ID: R01-4F6]
TA421643 100 µL

GAP43 Rabbit Monoclonal Antibody [Clone ID: R01-4F6]

Sign In for Pricing
View Details
IL6 (NM_000600) Human Recombinant Protein
TP720008 10 µg

IL6 (NM_000600) Human Recombinant Protein

Sign In for Pricing
View Details