Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF4 Peptide - C-terminal region

SF4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp434E2216, F23858, RBP, SF4

UniProt

Q8IWZ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_757386

Preservative

Lyophilized powder

AA Sequence

LGSEGQGIKNPVNKGTTTVDGAGFGIDRPAELSKEDDEYEAFRKRMMLAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL2L12 Recombinant Rabbit Monoclonal Antibody [JE51-66]
ET7110-02 100 µL

BCL2L12 Recombinant Rabbit Monoclonal Antibody [JE51-66]

Sign In for Pricing
View Details
(1S,2S)-1-(3-(Benzyloxy)phenyl)-2-(dibenzylamino)propan-1-ol
TRC-B347590-25MG 25 mg

(1S,2S)-1-(3-(Benzyloxy)phenyl)-2-(dibenzylamino)propan-1-ol

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS703481 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
MNDA (NM_002432) Human Over-expression Lysate
LC400871 20 µg

MNDA (NM_002432) Human Over-expression Lysate

Sign In for Pricing
View Details
SBF2 Human Gene Knockout Kit (CRISPR)
KN213601 1 Kit

SBF2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD22 (NM_001185101) Human Over-expression Lysate
LY434364 100 µg

CD22 (NM_001185101) Human Over-expression Lysate

Sign In for Pricing
View Details