Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC26A6 Peptide - C-terminal region

SLC26A6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp586E1422

UniProt

Q9BXS9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC26A6 Rabbit Polyclonal Antibody (orb331136) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_599025

Preservative

Lyophilized powder

AA Sequence

VNTSLEDMRSNNVEDCKMMVSSGDKMEDATANGQEDSKAPDGSTLKALGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fcna activation kit by CRISPRa
GA201378 1 Kit

Mouse Fcna activation kit by CRISPRa

Sign In for Pricing
View Details
Human TRAIL Recombinant Rabbit Monoclonal Antibody [PSH08-05] - BSA and Azide free (Capture)
HA722943 100 µL

Human TRAIL Recombinant Rabbit Monoclonal Antibody [PSH08-05] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
ODC1 Antibody
KC-7710-01 50 μL

ODC1 Antibody

Sign In for Pricing
View Details
ODC1 Antibody
KC-7710-02 100 µL

ODC1 Antibody

Sign In for Pricing
View Details
ODC1 Antibody
KC-7710-03 1 mL

ODC1 Antibody

Sign In for Pricing
View Details
PDLIM1 Recombinant Rabbit Monoclonal Antibody [JE55-21]
ET7110-99 100 µL

PDLIM1 Recombinant Rabbit Monoclonal Antibody [JE55-21]

Sign In for Pricing
View Details