Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC45A1 Peptide - N-terminal region

SLC45A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DNB5, FLJ26758, KIAA0458

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC45A1 Rabbit Polyclonal Antibody (orb325134) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_942788

Preservative

Lyophilized powder

AA Sequence

MELLREVSKKQKNSPNSSSVKNEVSVCWPLKYRARVKPKSEGGDECAILQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) WNT2 Polyclonal Antibody
MBS9004551 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) WNT2 Polyclonal Antibody

Sign In for Pricing
View Details
CAPN5 Blocking Peptide (N-Term)
MBS9230000-01 0.5 mg

CAPN5 Blocking Peptide (N-Term)

Sign In for Pricing
View Details
CAPN5 Blocking Peptide (N-Term)
MBS9230000-02 5x 0.5 mg

CAPN5 Blocking Peptide (N-Term)

Sign In for Pricing
View Details
Recombinant Human Jerky protein homolog-like (JERKL)
orb3004437-01 20 µg

Recombinant Human Jerky protein homolog-like (JERKL)

Sign In for Pricing
View Details
Recombinant Human Jerky protein homolog-like (JERKL)
orb3004437-02 100 µg

Recombinant Human Jerky protein homolog-like (JERKL)

Sign In for Pricing
View Details
Recombinant Human Jerky protein homolog-like (JERKL)
orb3004437-03 1 mg

Recombinant Human Jerky protein homolog-like (JERKL)

Sign In for Pricing
View Details