Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC45A1 Peptide - N-terminal region

SLC45A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DNB5, FLJ26758, KIAA0458

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC45A1 Rabbit Polyclonal Antibody (orb325134) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_942788

Preservative

Lyophilized powder

AA Sequence

MELLREVSKKQKNSPNSSSVKNEVSVCWPLKYRARVKPKSEGGDECAILQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fluorescent Long Range DNA Ladder
M-225S 500 μL

Fluorescent Long Range DNA Ladder

Sign In for Pricing
View Details
Txk CRISPR/Cas9 KO Plasmid (h)
sc-404884 20 µg

Txk CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
MCTP2 Antibody (Biotin)
orb515965-01 50 µg

MCTP2 Antibody (Biotin)

Sign In for Pricing
View Details
MCTP2 Antibody (Biotin)
orb515965-02 100 µg

MCTP2 Antibody (Biotin)

Sign In for Pricing
View Details
HBD Recombinant Protein
OPCD03813-50UG 50 µg

HBD Recombinant Protein

Sign In for Pricing
View Details
COPS4 Recombinant Antibody, Biotin Conjugated
bsm-62563R-Biotin 100 µL

COPS4 Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details