Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc6a9 Peptide - C-terminal region

Slc6a9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Glyt-1, Glyt1

UniProt

P28571

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc6a9 Rabbit Polyclonal Antibody (orb324996) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032161

Preservative

Lyophilized powder

AA Sequence

FQLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTTTPSPEDGFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX8-Specific Antibody
abx236177 100 µg

PAX8-Specific Antibody

Sign In for Pricing
View Details
Podoplanin Rabbit pAb (APR19859N)
APR19859N-01 50 µL

Podoplanin Rabbit pAb (APR19859N)

Sign In for Pricing
View Details
Podoplanin Rabbit pAb (APR19859N)
APR19859N-02 100 µL

Podoplanin Rabbit pAb (APR19859N)

Sign In for Pricing
View Details
Podoplanin Rabbit pAb (APR19859N)
APR19859N-03 200 µL

Podoplanin Rabbit pAb (APR19859N)

Sign In for Pricing
View Details
(E) -Labd-13-ene-8,15-diol
KAA26731-01 10 mg

(E) -Labd-13-ene-8,15-diol

Sign In for Pricing
View Details
(E) -Labd-13-ene-8,15-diol
KAA26731-02 25 mg

(E) -Labd-13-ene-8,15-diol

Sign In for Pricing
View Details