Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc6a9 Peptide - C-terminal region

Slc6a9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Glyt-1, Glyt1

UniProt

P28571

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Slc6a9 Rabbit Polyclonal Antibody (orb324996) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032161

Preservative

Lyophilized powder

AA Sequence

FQLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTTTPSPEDGFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MAGE 1 Antibody (MA454) [FITC]
NBP2-33094F 0.1 mL

Mouse Monoclonal MAGE 1 Antibody (MA454) [FITC]

Sign In for Pricing
View Details
CD47 Mouse Monoclonal Antibody [Clone 6A2]
E45M21167V-2 50 µL

CD47 Mouse Monoclonal Antibody [Clone 6A2]

Sign In for Pricing
View Details
Human PDGF-1
600285 0.01 mg

Human PDGF-1

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Fibroblast Growth Factor 15 (FGF15)
MBS2110775-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Fibroblast Growth Factor 15 (FGF15)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Fibroblast Growth Factor 15 (FGF15)
MBS2110775-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Fibroblast Growth Factor 15 (FGF15)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Fibroblast Growth Factor 15 (FGF15)
MBS2110775-03 0.5 mL

Cy3-Linked Monoclonal Antibody to Fibroblast Growth Factor 15 (FGF15)

Sign In for Pricing
View Details