Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOAT1 Peptide - middle region

SOAT1 Peptide - middle region

Product Specifications

Product Name Alternative

ACACT, ACAT, ACAT1, RP11-215I23.2, SOAT, STAT

UniProt

P35610

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SOAT1 Rabbit Polyclonal Antibody (orb579455) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003092

Preservative

Lyophilized powder

AA Sequence

ASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Influenza A virus (H5N1) NF (CsgA) -3M2e Protein, N-His
YVV23407 100 μg

Recombinant Influenza A virus (H5N1) NF (CsgA) -3M2e Protein, N-His

Sign In for Pricing
View Details
MCM2 Antibody
orb847857 2 mg

MCM2 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Spag8 shRNA (UAS) - Lentiviral mouse Spag8 shRNA (UAS, iRFP) (25)
GTR15244274 1 Vial

Lentiviral mouse Spag8 shRNA (UAS) - Lentiviral mouse Spag8 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
CD61 (Integrin beta 3 (Platelet Glycoprotein IIIa, Antigen CD61), Integrin beta-3, ITGB3, Platelet Membrane Glycoprotein IIIa, GP3A, GPIIIa) (MaxLight 550)
MBS6246217-01 0.1 mL

CD61 (Integrin beta 3 (Platelet Glycoprotein IIIa, Antigen CD61), Integrin beta-3, ITGB3, Platelet Membrane Glycoprotein IIIa, GP3A, GPIIIa) (MaxLight 550)

Sign In for Pricing
View Details
CD61 (Integrin beta 3 (Platelet Glycoprotein IIIa, Antigen CD61), Integrin beta-3, ITGB3, Platelet Membrane Glycoprotein IIIa, GP3A, GPIIIa) (MaxLight 550)
MBS6246217-02 5x 0.1 mL

CD61 (Integrin beta 3 (Platelet Glycoprotein IIIa, Antigen CD61), Integrin beta-3, ITGB3, Platelet Membrane Glycoprotein IIIa, GP3A, GPIIIa) (MaxLight 550)

Sign In for Pricing
View Details
SARS Coronavirus Membrane (Matrix), Recombinant discontinued. see C7901-24B1
544002 100 µg

SARS Coronavirus Membrane (Matrix), Recombinant discontinued. see C7901-24B1

Sign In for Pricing
View Details