Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPACA1 Peptide - N-terminal region

SPACA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC32952, SAMP32

UniProt

Q9HBV2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPACA1 Rabbit Polyclonal Antibody (orb580938) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112222

Preservative

Lyophilized powder

AA Sequence

TENNDSETAENYAPPETEDVSNRNVVKEVEFGMCTVTCGIGVREVILTNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Shikimic Acid Ethyl Ester
TRC-S357105-250MG 250 mg

Shikimic Acid Ethyl Ester

Sign In for Pricing
View Details
Cdk5rap1 Mouse Gene Knockout Kit (CRISPR)
KN503045 1 Kit

Cdk5rap1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Acetaldehyde-d3
TRC-A132601-25MG 25 mg

Acetaldehyde-d3

Sign In for Pricing
View Details
MGC13096 (PDCD2L) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E3]
TA812472BM 100 µL

MGC13096 (PDCD2L) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E3]

Sign In for Pricing
View Details
NGS Library Quantification Kit (for Small RNA-Seq)
61600 1 Unit

NGS Library Quantification Kit (for Small RNA-Seq)

Sign In for Pricing
View Details
CRY2 (C-term) Rabbit Polyclonal Antibody
AP13098PU-N 400 µL

CRY2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details