Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPIN1 Peptide - middle region

SPIN1 Peptide - middle region

Product Specifications

Product Name Alternative

SPIN

UniProt

Q9Y657

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPIN1 Rabbit Polyclonal Antibody (orb581635) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006708

Preservative

Lyophilized powder

AA Sequence

YQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKR

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUMO1P5 3'UTR Lenti-reporter-Luc Vector
45872081 1.0 µg

SUMO1P5 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
C20orf43 siRNA (h)
sc-72736 10 µM

C20orf43 siRNA (h)

Sign In for Pricing
View Details
Recombinant Mycobacterium Marinum MMAR_2384 Protein (aa 1-389)
VAng-Yyj4437-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Marinum MMAR_2384 Protein (aa 1-389)

Sign In for Pricing
View Details
Diablo homolog (DIABLO) polyclonal antibody
ABP-PAB-10267 100 ug

Diablo homolog (DIABLO) polyclonal antibody

Sign In for Pricing
View Details
Nsmce4a-set siRNA/shRNA/RNAi Lentivector (Rat)
32202096 4x 500 ng

Nsmce4a-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Phospholipase C, Recombinant, Clostridium Perfringens, aa29-398, His-Tag
585769-01 20 µg

Phospholipase C, Recombinant, Clostridium Perfringens, aa29-398, His-Tag

Sign In for Pricing
View Details